PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G02430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 330aa    MW: 35930.1 Da    PI: 5.7641
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G02430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-163087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..........kgRtlkqcksrwqkyl 48
                     rg+WT eEd llvd+++ +G g+W++ ar+            ++Rt+k+c++rw++yl
  OMERI05G02430.1 30 RGPWTVEEDMLLVDYIANHGEGRWNSLARCAAdrlrvwtrvgLRRTGKSCRLRWLNYL 87
                     89******************************************************97 PP

2Myb_DNA-binding50.93.5e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  OMERI05G02430.1  93 RGNITADEQLLILDLHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 136
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.452587IPR017930Myb domain
SuperFamilySSF466897.11E-2928134IPR009057Homeodomain-like
SMARTSM007172.4E-132989IPR001005SANT/Myb domain
PfamPF002497.3E-143087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-213194IPR009057Homeodomain-like
CDDcd001671.07E-93287No hitNo description
PROSITE profilePS5129422.52788142IPR017930Myb domain
SMARTSM007174.2E-1492140IPR001005SANT/Myb domain
PfamPF002491.5E-1493136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2295141IPR009057Homeodomain-like
CDDcd001673.22E-1097136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDLEMMGMAM SPAMSSATAA ASEDEGDLRR GPWTVEEDML LVDYIANHGE GRWNSLARCA  60
ADRLRVWTRV GLRRTGKSCR LRWLNYLRPD VRRGNITADE QLLILDLHSR WGNRWSKIAQ  120
YLPGRTDNEI KNYWRTRVQK HAKQLRCDVN SKEFRDVVRH VWMPRLVERI QADAAAAAAG  180
DDVAAAAPVS AAAMRSMSSP AGAMYLHHQQ IPLAAGAAMV APAASSEAYH HHGGGGGDTS  240
CSEPSQAAVT MSPDDASSTL RSSSAAAEND TIHGDVLSGS WSELLATTTT IAATGGRDGA  300
ATAGLPDFDE LGDFEDNLWS LEDIWLHQQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242713424120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638460.11e-173PREDICTED: transcription factor MYB108
TrEMBLA0A0E0DLN10.0A0A0E0DLN1_9ORYZ; Uncharacterized protein
STRINGORGLA05G0022200.11e-175(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-76myb domain protein 78